Lineage for d5hiyc_ (5hiy C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077691Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2077692Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2077705Family b.140.1.0: automated matches [191526] (1 protein)
    not a true family
  6. 2077706Protein automated matches [190886] (3 species)
    not a true protein
  7. 2285579Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)
  8. 2285656Domain d5hiyc_: 5hiy C: [328957]
    automated match to d1qz8a_
    mutant

Details for d5hiyc_

PDB Entry: 5hiy (more details), 3 Å

PDB Description: crystal structure of pedv nsp9 mutant-c59a
PDB Compounds: (C:) Non-structural protein 9

SCOPe Domain Sequences for d5hiyc_:

Sequence, based on SEQRES records: (download)

>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggantielep
prkflvdspngaqikylyfvrnlntlrrgavlgyigatv

Sequence, based on observed residues (ATOM records): (download)

>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwntielepprkflv
dspngaqikylyfvrnlntlrrgavlgyigatv

SCOPe Domain Coordinates for d5hiyc_:

Click to download the PDB-style file with coordinates for d5hiyc_.
(The format of our PDB-style files is described here.)

Timeline for d5hiyc_:

  • d5hiyc_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26