SCOPe 2.08: Domain d5hiyc_: 5hiy C:

Lineage for d5hiyc_ (5hiy C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.0: automated matches [191526] (1 protein)
   not a true family

6. Protein automated matches [190886] (4 species)
   not a true protein

7. Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)

8. Domain d5hiyc_: 5hiy C: [328957]
   automated match to d1qz8a_
   mutant

Details for d5hiyc_

PDB Entry: 5hiy, 3 Å

PDB Description: crystal structure of pedv nsp9 mutant-c59a

PDB Compounds: (C:) Non-structural protein 9

SCOPe Domain Sequences for d5hiyc_:

Sequence, based on SEQRES records:

>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggantielep
prkflvdspngaqikylyfvrnlntlrrgavlgyigatv

Sequence, based on observed residues (ATOM records):

>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwntielepprkflv
dspngaqikylyfvrnlntlrrgavlgyigatv

Timeline for d5hiyc_:

• d5hiyc_ first appeared in SCOPe 2.06
  
• d5hiyc_ appears in SCOPe 2.07