Class b: All beta proteins [48724] (180 folds) |
Fold b.140: Replicase NSP9 [101815] (1 superfamily) barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel |
Superfamily b.140.1: Replicase NSP9 [101816] (2 families) |
Family b.140.1.0: automated matches [191526] (1 protein) not a true family |
Protein automated matches [190886] (4 species) not a true protein |
Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries) |
Domain d5hiyc_: 5hiy C: [328957] automated match to d1qz8a_ mutant |
PDB Entry: 5hiy (more details), 3 Å
SCOPe Domain Sequences for d5hiyc_:
Sequence, based on SEQRES records: (download)
>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]} gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggantielep prkflvdspngaqikylyfvrnlntlrrgavlgyigatv
>d5hiyc_ b.140.1.0 (C:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]} gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwntielepprkflv dspngaqikylyfvrnlntlrrgavlgyigatv
Timeline for d5hiyc_: