SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hiyb_ (5hiy B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077691Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2077692Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2077705Family b.140.1.0: automated matches [191526] (1 protein)
    not a true family
  6. 2077706Protein automated matches [190886] (3 species)
    not a true protein
  7. 2285579Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)
  8. 2285630Domain d5hiyb_: 5hiy B: [328931]
    automated match to d1qz8a_
    mutant

Details for d5hiyb_

PDB Entry: 5hiy (more details), 3 Å

PDB Description: crystal structure of pedv nsp9 mutant-c59a
PDB Compounds: (B:) Non-structural protein 9

SCOPe Domain Sequences for d5hiyb_:

Sequence, based on SEQRES records: (download)

>d5hiyb_ b.140.1.0 (B:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
pgklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggantiele
pprkflvdspngaqikylyfvrnlntlrrgavlgyigatvr

Sequence, based on observed residues (ATOM records): (download)

>d5hiyb_ b.140.1.0 (B:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
pgklkqrsikaegdgvgegkalynneggrtfmyafisdkpdlrvvkwefntielepprkf
lvdspngaqikylyfvrnlntlrrgavlgyigatvr

SCOPe Domain Coordinates for d5hiyb_:

Click to download the PDB-style file with coordinates for d5hiyb_.
(The format of our PDB-style files is described here.)

Timeline for d5hiyb_:

  • d5hiyb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26