SCOPe 2.08: Domain d5thxa1: 5thx A:2-100

Lineage for d5thxa1 (5thx A:2-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:1351790] [324310] (2 PDB entries)

8. Domain d5thxa1: 5thx A:2-100 [324311]
   Other proteins in same PDB: d5thxa2
   automated match to d1a8pa1
   complexed with fad, mg, nap

Details for d5thxa1

PDB Entry: 5thx, 1.55 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5thxa1:

Sequence; same for both SEQRES and ATOM records:

>d5thxa1 b.43.4.0 (A:2-100) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
aafntqkvlsvhhwtdayftftcirdeslrfengqfvmvglmadgkplmraysvasanwe
ehleffsikvqdgpltsrlqhlkvgdevliskkptgtlv

Timeline for d5thxa1:

• d5thxa1 first appeared in SCOPe 2.06
  
• d5thxa1 appears in SCOPe 2.07