SCOPe 2.08: Domain d5thxa2: 5thx A:101-258

Lineage for d5thxa2 (5thx A:101-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:1351790] [324312] (2 PDB entries)

8. Domain d5thxa2: 5thx A:101-258 [324313]
   Other proteins in same PDB: d5thxa1
   automated match to d1a8pa2
   complexed with fad, mg, nap

Details for d5thxa2

PDB Entry: 5thx, 1.55 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5thxa2:

Sequence; same for both SEQRES and ATOM records:

>d5thxa2 c.25.1.0 (A:101-258) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
acdlnpgkhlyllstgtgiapflsitkdpeiyeqfekiilvhgvrykkdlayydrftkel
peheylgdlvkekliyypivsreefehrgrltdlmvsgklfediglpkinpqddramlcg
spamlkdtckvlddfgltvspktgvrgdylierafvdq

Timeline for d5thxa2:

• d5thxa2 first appeared in SCOPe 2.06
  
• d5thxa2 appears in SCOPe 2.07