Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (20 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:1351790] [324310] (2 PDB entries) |
Domain d5thxa1: 5thx A:2-100 [324311] Other proteins in same PDB: d5thxa2 automated match to d1a8pa1 complexed with fad, mg, nap |
PDB Entry: 5thx (more details), 1.55 Å
SCOPe Domain Sequences for d5thxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5thxa1 b.43.4.0 (A:2-100) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]} aafntqkvlsvhhwtdayftftcirdeslrfengqfvmvglmadgkplmraysvasanwe ehleffsikvqdgpltsrlqhlkvgdevliskkptgtlv
Timeline for d5thxa1: