Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries) |
Domain d5le5q_: 5le5 Q: [321495] Other proteins in same PDB: d5le5d_, d5le5e_, d5le5f_, d5le5g_, d5le5h_, d5le5i_, d5le5j_, d5le5k_, d5le5l_, d5le5m_, d5le5n_, d5le5r_, d5le5s_, d5le5t_, d5le5u_, d5le5v_, d5le5w_, d5le5x_, d5le5y_, d5le5z_ automated match to d1irud_ complexed with 1pe, cl, k, mg |
PDB Entry: 5le5 (more details), 1.8 Å
SCOPe Domain Sequences for d5le5q_:
Sequence, based on SEQRES records: (download)
>d5le5q_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
>d5le5q_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai etddltiklvikallevvnielavmrrdqslkilnpeeiekyvaeiekekeene
Timeline for d5le5q_: