Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries) |
Domain d5le5t_: 5le5 T: [321561] Other proteins in same PDB: d5le5a_, d5le5b_, d5le5c_, d5le5d_, d5le5g_, d5le5h_, d5le5j_, d5le5k_, d5le5l_, d5le5n_, d5le5o_, d5le5p_, d5le5q_, d5le5r_, d5le5u_, d5le5v_, d5le5x_, d5le5y_, d5le5z_ automated match to d4g4sg_ complexed with 1pe, cl, k, mg |
PDB Entry: 5le5 (more details), 1.8 Å
SCOPe Domain Sequences for d5le5t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5le5t_ d.153.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnk rlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytl ysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkem tcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk
Timeline for d5le5t_: