Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d5le5j_: 5le5 J: [321555] Other proteins in same PDB: d5le5a_, d5le5b_, d5le5c_, d5le5e_, d5le5f_, d5le5i_, d5le5k_, d5le5l_, d5le5m_, d5le5n_, d5le5o_, d5le5p_, d5le5q_, d5le5s_, d5le5t_, d5le5w_, d5le5y_, d5le5z_ automated match to d1iruk_ complexed with 1pe, cl, k, mg |
PDB Entry: 5le5 (more details), 1.8 Å
SCOPe Domain Sequences for d5le5j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5le5j_ d.153.1.4 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv riidkngihdldnisf
Timeline for d5le5j_: