Lineage for d5le5i_ (5le5 I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996355Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries)
  8. 2996358Domain d5le5i_: 5le5 I: [321532]
    Other proteins in same PDB: d5le5a_, d5le5b_, d5le5c_, d5le5d_, d5le5g_, d5le5h_, d5le5j_, d5le5k_, d5le5l_, d5le5n_, d5le5o_, d5le5p_, d5le5q_, d5le5r_, d5le5u_, d5le5v_, d5le5x_, d5le5y_, d5le5z_
    automated match to d3unfl_
    complexed with 1pe, cl, k, mg

Details for d5le5i_

PDB Entry: 5le5 (more details), 1.8 Å

PDB Description: native human 20s proteasome at 1.8 angstrom
PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5le5i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5le5i_ d.153.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
gmgvivhiiekdkittrtlkarmd

SCOPe Domain Coordinates for d5le5i_:

Click to download the PDB-style file with coordinates for d5le5i_.
(The format of our PDB-style files is described here.)

Timeline for d5le5i_: