| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d1ty6l3: 1ty6 L:1-107 [303130] Other proteins in same PDB: d1ty6a_, d1ty6b4, d1ty6b5, d1ty6b6, d1ty6h_, d1ty6l4 automated match to d1a5fl1 complexed with ca, gol, mg, nag, ndg |
PDB Entry: 1ty6 (more details), 2.9 Å
SCOPe Domain Sequences for d1ty6l3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty6l3 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik
Timeline for d1ty6l3: