Lineage for d1ty6l3 (1ty6 L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370543Domain d1ty6l3: 1ty6 L:1-107 [303130]
    Other proteins in same PDB: d1ty6a_, d1ty6b4, d1ty6b5, d1ty6b6, d1ty6l4
    automated match to d1a5fl1
    complexed with ca, gol, mg, nag, ndg

Details for d1ty6l3

PDB Entry: 1ty6 (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d1ty6l3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty6l3 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d1ty6l3:

Click to download the PDB-style file with coordinates for d1ty6l3.
(The format of our PDB-style files is described here.)

Timeline for d1ty6l3: