Lineage for d5bo4h_ (5bo4 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931392Domain d5bo4h_: 5bo4 H: [274693]
    Other proteins in same PDB: d5bo4a1, d5bo4a2, d5bo4a3, d5bo4c1, d5bo4c2, d5bo4d1, d5bo4d2, d5bo4d3, d5bo4f_, d5bo4g1, d5bo4g2, d5bo4g3, d5bo4i1, d5bo4i2, d5bo4j1, d5bo4j2, d5bo4j3, d5bo4l1, d5bo4l2, d5bo4m1, d5bo4m2, d5bo4o_, d5bo4p1, d5bo4p2, d5bo4r_
    automated match to d1lqba_

Details for d5bo4h_

PDB Entry: 5bo4 (more details), 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals
PDB Compounds: (H:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d5bo4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bo4h_ d.15.1.1 (H:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5bo4h_:

Click to download the PDB-style file with coordinates for d5bo4h_.
(The format of our PDB-style files is described here.)

Timeline for d5bo4h_: