PDB entry 5bo4

View 5bo4 on RCSB PDB site
Description: Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals
Class: signaling protein
Keywords: Signaling Protein, Ubiquitin Ligase, Suppressor of Cytokine Signalling
Deposited on 2015-05-27, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14508 (2-168)
      • expression tag (1)
    Domains in SCOPe 2.07: d5bo4a1, d5bo4a2, d5bo4a3
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4b_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5bo4c1, d5bo4c2
  • Chain 'D':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14508 (2-168)
      • expression tag (1)
    Domains in SCOPe 2.07: d5bo4d1, d5bo4d2, d5bo4d3
  • Chain 'E':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4e_
  • Chain 'F':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4f_
  • Chain 'G':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14508 (2-168)
      • expression tag (1)
    Domains in SCOPe 2.07: d5bo4g1, d5bo4g2, d5bo4g3
  • Chain 'H':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4h_
  • Chain 'I':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5bo4i1, d5bo4i2
  • Chain 'J':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14508 (2-168)
      • expression tag (1)
    Domains in SCOPe 2.07: d5bo4j1, d5bo4j2, d5bo4j3
  • Chain 'K':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4k_
  • Chain 'L':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5bo4l1, d5bo4l2
  • Chain 'M':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4m1, d5bo4m2
  • Chain 'N':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4o_
  • Chain 'P':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOCS2, CIS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4p1, d5bo4p2
  • Chain 'Q':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4q_
  • Chain 'R':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bo4r_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bo4A (A:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4A (A:)
    mqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsa
    gptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslq
    hlcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bo4B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4B (B:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bo4C (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4C (C:)
    mmyvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvrytnss
    teipefpiapeialellmaanfldc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bo4D (D:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4D (D:)
    mqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsa
    gptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslq
    hlcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bo4E (E:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4E (E:)
    dvflmirrhkttiftdesstvfelkrivegilkrppdeqrlykddqllddgktlgecgft
    sqtarpqapatvglafraddtfealciepfssppe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bo4F (F:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4F (F:)
    myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryeipef
    piapeialellmaanfldc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bo4G (G:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4G (G:)
    mqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsa
    gptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslq
    hlcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bo4H (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4H (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bo4I (I:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4I (I:)
    mmyvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bo4J (J:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4J (J:)
    mqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsa
    gptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslq
    hlcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5bo4K (K:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4K (K:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5bo4L (L:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4L (L:)
    mmyvklissdghefivkrehaltsgtikamevnfreipshvlskvcmyftykvrytnsst
    eipefpiapeialellmaanfldc
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5bo4M (M:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4M (M:)
    qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
    ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslqh
    lcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5bo4O (O:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4O (O:)
    myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvryipef
    piapeialellmaanfldc
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5bo4P (P:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4P (P:)
    qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
    ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslqh
    lcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5bo4Q (Q:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4Q (Q:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5bo4R (R:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bo4R (R:)
    myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvryeipe
    fpiapeialellmaanfldc