SCOPe 2.08: Domain d5bo4g1: 5bo4 G:32-134

Lineage for d5bo4g1 (5bo4 G:32-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160563] (2 PDB entries)
   Uniprot O14508 32-134

8. Domain d5bo4g1: 5bo4 G:32-134 [274690]
   Other proteins in same PDB: d5bo4a2, d5bo4a3, d5bo4b_, d5bo4c1, d5bo4c2, d5bo4d2, d5bo4d3, d5bo4e_, d5bo4f_, d5bo4g2, d5bo4g3, d5bo4h_, d5bo4i1, d5bo4i2, d5bo4j2, d5bo4j3, d5bo4k_, d5bo4l1, d5bo4l2, d5bo4m2, d5bo4o_, d5bo4p2, d5bo4q_, d5bo4r_
   automated match to d2c9wa2

Details for d5bo4g1

PDB Entry: 5bo4, 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals

PDB Compounds: (G:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d5bo4g1:

Sequence; same for both SEQRES and ATOM records:

>d5bo4g1 d.93.1.1 (G:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

Timeline for d5bo4g1:

• d5bo4g1 first appeared in SCOPe 2.05
  
• d5bo4g1 appears in SCOPe 2.07