SCOPe 2.06: Domain d5by6c_: 5by6 C:

Lineage for d5by6c_ (5by6 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (15 species)
   not a true protein

7. Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)

8. Domain d5by6c_: 5by6 C: [273886]
   automated match to d4irra_
   complexed with dtt, gol, ump

Details for d5by6c_

PDB Entry: 5by6, 1.9 Å

PDB Description: crystal structure of trichinella spiralis thymidylate synthase complexed with dump

PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d5by6c_:

Sequence; same for both SEQRES and ATOM records:

>d5by6c_ d.117.1.1 (C:) automated matches {Trichinella spiralis [TaxId: 6334]}
yvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwrg
vveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhfg
cpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfyv
adgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthvd
alkvqmerkprpfpklkilrnveniddfraedfelinykpypkism

Timeline for d5by6c_:

• d5by6c_ first appeared in SCOPe 2.05
  
• d5by6c_ appears in SCOPe 2.07
  
• d5by6c_ appears in the current release, SCOPe 2.08