SCOPe 2.06: Domain d5by6d_: 5by6 D:

Lineage for d5by6d_ (5by6 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (15 species)
   not a true protein

7. Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)

8. Domain d5by6d_: 5by6 D: [273888]
   automated match to d4irra_
   complexed with dtt, gol, ump

Details for d5by6d_

PDB Entry: 5by6, 1.9 Å

PDB Description: crystal structure of trichinella spiralis thymidylate synthase complexed with dump

PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5by6d_:

Sequence; same for both SEQRES and ATOM records:

>d5by6d_ d.117.1.1 (D:) automated matches {Trichinella spiralis [TaxId: 6334]}
yvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwrg
vveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhfg
cpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfyv
adgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthvd
alkvqmerkprpfpklkilrnveniddfraedfelinykpyp

Timeline for d5by6d_:

• d5by6d_ first appeared in SCOPe 2.05
  
• d5by6d_ appears in SCOPe 2.07
  
• d5by6d_ appears in the current release, SCOPe 2.08