Lineage for d5by6a_ (5by6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212382Protein automated matches [190469] (15 species)
    not a true protein
  7. 2212559Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)
  8. 2212562Domain d5by6a_: 5by6 A: [273889]
    automated match to d4irra_
    complexed with dtt, gol, ump

Details for d5by6a_

PDB Entry: 5by6 (more details), 1.9 Å

PDB Description: crystal structure of trichinella spiralis thymidylate synthase complexed with dump
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d5by6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5by6a_ d.117.1.1 (A:) automated matches {Trichinella spiralis [TaxId: 6334]}
dyvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwr
gvveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhf
gcpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfy
vadgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthv
dalkvqmerkprpfpklkilrnveniddfraedfelinykpypk

SCOPe Domain Coordinates for d5by6a_:

Click to download the PDB-style file with coordinates for d5by6a_.
(The format of our PDB-style files is described here.)

Timeline for d5by6a_: