Lineage for d5by6c_ (5by6 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579306Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)
  8. 2579311Domain d5by6c_: 5by6 C: [273886]
    automated match to d4irra_
    complexed with dtt, gol, ump

Details for d5by6c_

PDB Entry: 5by6 (more details), 1.9 Å

PDB Description: crystal structure of trichinella spiralis thymidylate synthase complexed with dump
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d5by6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5by6c_ d.117.1.1 (C:) automated matches {Trichinella spiralis [TaxId: 6334]}
yvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwrg
vveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhfg
cpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfyv
adgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthvd
alkvqmerkprpfpklkilrnveniddfraedfelinykpypkism

SCOPe Domain Coordinates for d5by6c_:

Click to download the PDB-style file with coordinates for d5by6c_.
(The format of our PDB-style files is described here.)

Timeline for d5by6c_: