| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4y4hg2: 4y4h G:116-204 [273254] Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hb_, d4y4hc1, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hf_, d4y4hg1, d4y4hh1, d4y4hh2 automated match to d2pyfa2 complexed with 49x, nag |
PDB Entry: 4y4h (more details), 3.1 Å
SCOPe Domain Sequences for d4y4hg2:
Sequence, based on SEQRES records: (download)
>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps
Timeline for d4y4hg2: