SCOPe 2.08: Domain d4y4hg2: 4y4h G:116-204

Lineage for d4y4hg2 (4y4h G:116-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4y4hg2: 4y4h G:116-204 [273254]
   Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hb_, d4y4hc1, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hf_, d4y4hg1, d4y4hh1, d4y4hh2
   automated match to d2pyfa2
   complexed with 49x, nag

Details for d4y4hg2

PDB Entry: 4y4h, 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex

PDB Compounds: (G:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain)

SCOPe Domain Sequences for d4y4hg2:

Sequence, based on SEQRES records:

>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d4y4hg2:

• d4y4hg2 first appeared in SCOPe 2.05
  
• d4y4hg2 appears in SCOPe 2.07