Lineage for d4y4hg2 (4y4h G:116-204)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763607Domain d4y4hg2: 4y4h G:116-204 [273254]
    Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hb_, d4y4hc1, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hf_, d4y4hg1, d4y4hh1, d4y4hh2
    automated match to d2pyfa2
    complexed with 49x, nag

Details for d4y4hg2

PDB Entry: 4y4h (more details), 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex
PDB Compounds: (G:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain)

SCOPe Domain Sequences for d4y4hg2:

Sequence, based on SEQRES records: (download)

>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4y4hg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4y4hg2:

Click to download the PDB-style file with coordinates for d4y4hg2.
(The format of our PDB-style files is described here.)

Timeline for d4y4hg2: