SCOPe 2.08: Domain d4pd4c2: 4pd4 C:262-385

Lineage for d4pd4c2 (4pd4 C:262-385)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257469] (3 PDB entries)

8. Domain d4pd4c2: 4pd4 C:262-385 [257470]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d1kb9c1
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4c2

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d4pd4c2:

Sequence; same for both SEQRES and ATOM records:

>d4pd4c2 f.32.1.0 (C:262-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d4pd4c2:

• d4pd4c2 first appeared in SCOPe 2.04
  
• d4pd4c2 appears in SCOPe 2.07