Lineage for d4pd4c1 (4pd4 C:1-261)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024589Protein automated matches [196844] (6 species)
    not a true protein
  7. 3024590Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257467] (3 PDB entries)
  8. 3024594Domain d4pd4c1: 4pd4 C:1-261 [257468]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d1kb9c2
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4c1

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d4pd4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4c1 f.21.1.2 (C:1-261) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

SCOPe Domain Coordinates for d4pd4c1:

Click to download the PDB-style file with coordinates for d4pd4c1.
(The format of our PDB-style files is described here.)

Timeline for d4pd4c1: