Lineage for d4pd4c2 (4pd4 C:262-385)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699388Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1699389Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1699453Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 1699454Protein automated matches [254431] (4 species)
    not a true protein
  7. 1699471Species Saccharomyces cerevisiae [TaxId:559292] [257469] (1 PDB entry)
  8. 1699472Domain d4pd4c2: 4pd4 C:262-385 [257470]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d1kb9c1
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4c2

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d4pd4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4c2 f.32.1.0 (C:262-385) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOPe Domain Coordinates for d4pd4c2:

Click to download the PDB-style file with coordinates for d4pd4c2.
(The format of our PDB-style files is described here.)

Timeline for d4pd4c2: