Lineage for d4pd4b2 (4pd4 B:219-368)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005158Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 3005400Protein automated matches [254430] (2 species)
    not a true protein
  7. 3005401Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257462] (3 PDB entries)
  8. 3005417Domain d4pd4b2: 4pd4 B:219-368 [257466]
    Other proteins in same PDB: d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d3cx5b2
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4b2

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d4pd4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4b2 d.185.1.1 (B:219-368) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

SCOPe Domain Coordinates for d4pd4b2:

Click to download the PDB-style file with coordinates for d4pd4b2.
(The format of our PDB-style files is described here.)

Timeline for d4pd4b2: