![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (7 PDB entries) |
![]() | Domain d4pd4f_: 4pd4 F: [257479] Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d1kb9f_ complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4f_ f.28.1.1 (F:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy ldtataprlfdklk
Timeline for d4pd4f_: