| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4l4vg2: 4l4v G:111-198 [227537] Other proteins in same PDB: d4l4va1, d4l4va2, d4l4vb_, d4l4vc1, d4l4vc2, d4l4vc3, d4l4vd1, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vh1, d4l4vh2 automated match to d2f54d2 complexed with 1vy, gol |
PDB Entry: 4l4v (more details), 1.9 Å
SCOPe Domain Sequences for d4l4vg2:
Sequence, based on SEQRES records: (download)
>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp
>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnf
acanafnnsiipedtffp
Timeline for d4l4vg2: