Lineage for d4l4vg2 (4l4v G:111-198)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294351Domain d4l4vg2: 4l4v G:111-198 [227537]
    Other proteins in same PDB: d4l4vd1, d4l4ve1, d4l4ve2, d4l4vg1, d4l4vh1, d4l4vh2
    automated match to d2f54d2
    complexed with 1vy, gol

Details for d4l4vg2

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4vg2:

Sequence, based on SEQRES records: (download)

>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnf
acanafnnsiipedtffp

SCOPe Domain Coordinates for d4l4vg2:

Click to download the PDB-style file with coordinates for d4l4vg2.
(The format of our PDB-style files is described here.)

Timeline for d4l4vg2: