SCOPe 2.06: Domain d2v7ha2: 2v7h A:108-214

Lineage for d2v7ha2 (2v7h A:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d2v7ha2: 2v7h A:108-214 [198385]
   Other proteins in same PDB: d2v7ha1, d2v7hb2, d2v7hb3, d2v7hh2, d2v7hh3, d2v7hl1
   automated match to d1dqdl2

Details for d2v7ha2

PDB Entry: 2v7h, 2.8 Å

PDB Description: crystal structure of an immunogen specific anti-mannopyranoside monoclonal antibody fab fragment

PDB Compounds: (A:) monoclonal antibody

SCOPe Domain Sequences for d2v7ha2:

Sequence; same for both SEQRES and ATOM records:

>d2v7ha2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsarqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2v7ha2:

• d2v7ha2 first appeared in SCOPe 2.03
  
• d2v7ha2 appears in SCOPe 2.05
  
• d2v7ha2 appears in SCOPe 2.07
  
• d2v7ha2 appears in the current release, SCOPe 2.08