Lineage for d2v7hb3 (2v7h B:1-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021842Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2021922Domain d2v7hb3: 2v7h B:1-121 [262236]
    Other proteins in same PDB: d2v7ha1, d2v7ha2, d2v7hb2, d2v7hh2, d2v7hl1, d2v7hl2

Details for d2v7hb3

PDB Entry: 2v7h (more details), 2.8 Å

PDB Description: crystal structure of an immunogen specific anti-mannopyranoside monoclonal antibody fab fragment
PDB Compounds: (B:) monoclonal antibody

SCOPe Domain Sequences for d2v7hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7hb3 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny
nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvss

SCOPe Domain Coordinates for d2v7hb3:

Click to download the PDB-style file with coordinates for d2v7hb3.
(The format of our PDB-style files is described here.)

Timeline for d2v7hb3: