Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries) Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4 |
Domain d2v7hh3: 2v7h H:1-121 [262238] Other proteins in same PDB: d2v7ha1, d2v7ha2, d2v7hb2, d2v7hh2, d2v7hl1, d2v7hl2 |
PDB Entry: 2v7h (more details), 2.8 Å
SCOPe Domain Sequences for d2v7hh3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7hh3 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvss
Timeline for d2v7hh3: