Lineage for d3bz2u_ (3bz2 U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716660Protein automated matches [191005] (3 species)
    not a true protein
  7. 2716667Species Thermosynechococcus elongatus [TaxId:32046] [188750] (2 PDB entries)
  8. 2716668Domain d3bz2u_: 3bz2 U: [172962]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2u_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d3bz2u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2u_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d3bz2u_:

Click to download the PDB-style file with coordinates for d3bz2u_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2u_: