Lineage for d3bz2b_ (3bz2 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028867Protein Photosystem II core light harvesting protein PsbB [161079] (2 species)
  7. 3028868Species Thermosynechococcus elongatus [TaxId:146786] [161080] (7 PDB entries)
    Uniprot Q8DIQ1 2-489
  8. 3028873Domain d3bz2b_: 3bz2 B: [199136]
    Other proteins in same PDB: d3bz2a_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2b_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (B:) Photosystem II core light harvesting protein

SCOPe Domain Sequences for d3bz2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2b_ f.55.1.1 (B:) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqv

SCOPe Domain Coordinates for d3bz2b_:

Click to download the PDB-style file with coordinates for d3bz2b_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2b_: