Lineage for d2y69h_ (2y69 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000550Protein automated matches [190271] (1 species)
    not a true protein
  7. 2000551Species Cow (Bos taurus) [TaxId:9913] [187063] (19 PDB entries)
  8. 2000577Domain d2y69h_: 2y69 H: [170639]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
    automated match to d1ocrh_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69h_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2y69h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d2y69h_:

Click to download the PDB-style file with coordinates for d2y69h_.
(The format of our PDB-style files is described here.)

Timeline for d2y69h_: