![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (16 PDB entries) |
![]() | Domain d2y69h_: 2y69 H: [170639] Other proteins in same PDB: d2y69a_, d2y69c_, d2y69g_, d2y69i_, d2y69l_, d2y69n_, d2y69p_, d2y69t_, d2y69v_, d2y69y_ automated match to d1ocrh_ complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs twddrraegtfpgki
Timeline for d2y69h_: