Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187061] (16 PDB entries) |
Domain d2y69n_: 2y69 N: [170642] Other proteins in same PDB: d2y69c_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69p_, d2y69t_, d2y69u_, d2y69v_, d2y69y_ automated match to d1occa_ complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69n_ f.24.1.1 (N:) automated matches {Cow (Bos taurus) [TaxId: 9913]} finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre vltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d2y69n_: