Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
Protein automated matches [191230] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [189651] (1 PDB entry) |
Domain d2y69g_: 2y69 G: [170638] Other proteins in same PDB: d2y69a_, d2y69c_, d2y69h_, d2y69i_, d2y69l_, d2y69n_, d2y69p_, d2y69u_, d2y69v_, d2y69y_ automated match to d1occg_ complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69g_ f.23.2.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d2y69g_: