SCOPe 2.01: Domain d2y69a_: 2y69 A:

Lineage for d2y69a_ (2y69 A:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187061] (16 PDB entries)

8. Domain d2y69a_: 2y69 A: [170636]
   Other proteins in same PDB: d2y69c_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69p_, d2y69t_, d2y69u_, d2y69v_, d2y69y_
   automated match to d1occa_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69a_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2y69a_:

Sequence; same for both SEQRES and ATOM records:

>d2y69a_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah
afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag
agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt
plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp
evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt
rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans
sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv
nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre
vltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d2y69a_:

• d2y69a_ is new in SCOPe 2.01-stable
  
• d2y69a_ appears in SCOPe 2.02
  
• d2y69a_ appears in the current release, SCOPe 2.08