SCOPe 2.06: Domain d2y69s_: 2y69 S:

Lineage for d2y69s_ (2y69 S:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein automated matches [254652] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255694] (2 PDB entries)

8. Domain d2y69s_: 2y69 S: [239030]
   Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d3ag3f_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69s_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d2y69s_:

Sequence; same for both SEQRES and ATOM records:

>d2y69s_ g.41.5.3 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql

Timeline for d2y69s_:

• d2y69s_ first appeared in SCOPe 2.04
  
• d2y69s_ appears in SCOPe 2.05
  
• d2y69s_ appears in SCOPe 2.07
  
• d2y69s_ appears in the current release, SCOPe 2.08