SCOPe 2.06: Domain d2y69o1: 2y69 O:2-90

Lineage for d2y69o1 (2y69 O:2-90)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (35 PDB entries)

8. Domain d2y69o1: 2y69 O:2-90 [198671]
   Other proteins in same PDB: d2y69a_, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d1v54b2
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69o1

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2y69o1:

Sequence; same for both SEQRES and ATOM records:

>d2y69o1 f.17.2.1 (O:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev
etiwtilpaiililialpslrilymmdei

Timeline for d2y69o1:

• d2y69o1 first appeared in SCOPe 2.03
  
• d2y69o1 appears in SCOPe 2.05
  
• d2y69o1 appears in SCOPe 2.07
  
• d2y69o1 appears in the current release, SCOPe 2.08