Lineage for d2y69l_ (2y69 L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2253970Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 2253971Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 2254042Protein automated matches [191231] (1 species)
    not a true protein
  7. 2254043Species Cow (Bos taurus) [TaxId:9913] [189652] (2 PDB entries)
  8. 2254044Domain d2y69l_: 2y69 L: [170641]
    Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69z_
    automated match to d1occl_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69l_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (L:) Cytochrome c oxidase subunit 7C

SCOPe Domain Sequences for d2y69l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69l_ f.23.6.1 (L:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d2y69l_:

Click to download the PDB-style file with coordinates for d2y69l_.
(The format of our PDB-style files is described here.)

Timeline for d2y69l_: