Lineage for d3d5ce1 (3d5c E:5-154)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070814Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 1070815Protein 30S subunit [58133] (1 species)
  7. 1070816Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1070820Domain d3d5ce1: 3d5c E:5-154 [157369]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d1fkae_
    complexed with mg, zn

Details for d3d5ce1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d3d5ce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ce1 i.1.1.3 (E:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d3d5ce1:

Click to download the PDB-style file with coordinates for d3d5ce1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ce1: