Lineage for d3d5cn1 (3d5c N:2-61)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065744Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1065745Protein Ribosomal protein S14 [57753] (2 species)
  7. 1065771Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1065793Domain d3d5cn1: 3d5c N:2-61 [157377]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d1fjgn_
    complexed with mg, zn

Details for d3d5cn1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d3d5cn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5cn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d3d5cn1:

Click to download the PDB-style file with coordinates for d3d5cn1.
(The format of our PDB-style files is described here.)

Timeline for d3d5cn1: