Lineage for d3d5cr1 (3d5c R:19-88)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907572Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 907573Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 907574Protein Ribosomal protein S18 [46913] (2 species)
  7. 907600Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 907622Domain d3d5cr1: 3d5c R:19-88 [157381]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d2j00r1
    complexed with mg, zn

Details for d3d5cr1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d3d5cr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5cr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d3d5cr1:

Click to download the PDB-style file with coordinates for d3d5cr1.
(The format of our PDB-style files is described here.)

Timeline for d3d5cr1: