Lineage for d3d5cj1 (3d5c J:3-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029014Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1029015Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1029016Protein Ribosomal protein S10 [55001] (2 species)
  7. 1029042Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1029064Domain d3d5cj1: 3d5c J:3-100 [157374]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d1fjgj_
    complexed with mg, zn

Details for d3d5cj1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d3d5cj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5cj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d3d5cj1:

Click to download the PDB-style file with coordinates for d3d5cj1.
(The format of our PDB-style files is described here.)

Timeline for d3d5cj1: