![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.3: Small subunit [58132] (1 protein) |
![]() | Protein 30S subunit [58133] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
![]() | Domain d1fkae_: 1fka E: [45848] protein/RNA complex; complexed with wo2 |
PDB Entry: 1fka (more details), 3.3 Å
SCOPe Domain Sequences for d1fkae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkae_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus [TaxId: 274]} mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt kelgsrnpiniayatmealrqlrtkadverlrkgeah
Timeline for d1fkae_: