Lineage for d2qbbu1 (2qbb U:3-53)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1253012Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1253013Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1253014Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1253015Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1253016Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1253030Domain d2qbbu1: 2qbb U:3-53 [150400]
    Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbs1, d2qbbt1
    automatically matched to 2AVY U:3-53
    protein/RNA complex; complexed with lll, mg

Details for d2qbbu1

PDB Entry: 2qbb (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qbbu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbbu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2qbbu1:

Click to download the PDB-style file with coordinates for d2qbbu1.
(The format of our PDB-style files is described here.)

Timeline for d2qbbu1: