![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
![]() | Domain d2qbbs1: 2qbb S:2-80 [150398] Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbt1, d2qbbu1 automatically matched to 2AVY S:2-80 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbb (more details), 3.54 Å
SCOPe Domain Sequences for d2qbbs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbbs1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2qbbs1: