![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
![]() | Domain d2qbbt1: 2qbb T:2-86 [150399] Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbs1, d2qbbu1 automatically matched to 2AVY T:2-86 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbb (more details), 3.54 Å
SCOPe Domain Sequences for d2qbbt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbbt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa akglihknkaarhkanltaqinkla
Timeline for d2qbbt1: