Lineage for d2qbbr1 (2qbb R:19-73)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080920Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1080921Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1080922Protein Ribosomal protein S18 [46913] (2 species)
  7. 1080923Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1080937Domain d2qbbr1: 2qbb R:19-73 [150397]
    Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbs1, d2qbbt1, d2qbbu1
    automatically matched to 2AVY R:19-73
    protein/RNA complex; complexed with lll, mg

Details for d2qbbr1

PDB Entry: 2qbb (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qbbr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbbr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2qbbr1:

Click to download the PDB-style file with coordinates for d2qbbr1.
(The format of our PDB-style files is described here.)

Timeline for d2qbbr1: