![]() | Class j: Peptides [58231] (121 folds) |
![]() | Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) ![]() |
![]() | Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
![]() | Protein Ribosomal protein S21, RpsU [161310] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
![]() | Domain d2qbbu1: 2qbb U:3-53 [150400] Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbs1, d2qbbt1 automatically matched to 2AVY U:3-53 complexed with lll, mg |
PDB Entry: 2qbb (more details), 3.54 Å
SCOP Domain Sequences for d2qbbu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbbu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2qbbu1: